PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008229574.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 340aa    MW: 39672 Da    PI: 8.1213
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008229574.2genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM158.33.2e-49231511128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     + pGfrFhPtdeelv +yLkkkve+k++++ e ik++diyk++PwdLpk  + +eke+yfF++r +ky+++ r+nr+t sg+Wkatg dk+++s 
  XP_008229574.2  23 MLPGFRFHPTDEELVGFYLKKKVEKKPISM-ELIKQIDIYKYDPWDLPKVSTVGEKECYFFCRRGRKYRNSIRPNRVTGSGFWKATGIDKPIYSV 116
                     579***************************.99***************87778999**************************************7 PP

             NAM  96 kgel..vglkktLvfykgrapkgektdWvmheyrl 128
                     k+ l  +glkk+Lv+y+g+a kg+ktdW+m+e+rl
  XP_008229574.2 117 KEPLecIGLKKSLVYYRGSAGKGTKTDWMMNEFRL 151
                     443355***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.96E-5222182IPR003441NAC domain
PROSITE profilePS5100550.8723183IPR003441NAC domain
PfamPF023654.3E-2425151IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005992Biological Processtrehalose biosynthetic process
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006561Biological Processproline biosynthetic process
GO:0009718Biological Processanthocyanin-containing compound biosynthetic process
GO:0010120Biological Processcamalexin biosynthetic process
GO:0042538Biological Processhyperosmotic salinity response
GO:1900056Biological Processnegative regulation of leaf senescence
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MEVAKVMRNS SDQKVKDDDE EMMLPGFRFH PTDEELVGFY LKKKVEKKPI SMELIKQIDI  60
YKYDPWDLPK VSTVGEKECY FFCRRGRKYR NSIRPNRVTG SGFWKATGID KPIYSVKEPL  120
ECIGLKKSLV YYRGSAGKGT KTDWMMNEFR LPPHGHGKTT NFLNAKDITQ EAEVWTLCRI  180
FKRIPSYKKY TPDNWKEGNT KQNPTDSSSK TCSFESENYC GEPHVSPQDS VVMQRIERSS  240
SKPVRVDEQV DETNQWFTFV GETPYATSYS SLRDIPTDND FFINGNWDEL RPVVQLAADP  300
SSRVYDCIDW FRHIWRVVCT SNLYFCFFSF SVSLLFSVSW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-452518919171NO APICAL MERISTEM PROTEIN
1ut4_B4e-452518919171NO APICAL MERISTEM PROTEIN
1ut7_A4e-452518919171NO APICAL MERISTEM PROTEIN
1ut7_B4e-452518919171NO APICAL MERISTEM PROTEIN
3swm_A5e-452518922174NAC domain-containing protein 19
3swm_B5e-452518922174NAC domain-containing protein 19
3swm_C5e-452518922174NAC domain-containing protein 19
3swm_D5e-452518922174NAC domain-containing protein 19
3swp_A5e-452518922174NAC domain-containing protein 19
3swp_B5e-452518922174NAC domain-containing protein 19
3swp_C5e-452518922174NAC domain-containing protein 19
3swp_D5e-452518922174NAC domain-containing protein 19
4dul_A4e-452518919171NAC domain-containing protein 19
4dul_B4e-452518919171NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00310DAPTransfer from AT2G43000Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008229574.10.0PREDICTED: transcription factor JUNGBRUNNEN 1
SwissprotQ9SK551e-86NAC42_ARATH; Transcription factor JUNGBRUNNEN 1
TrEMBLM5WUY30.0M5WUY3_PRUPE; Uncharacterized protein
STRINGVIT_12s0028g00860.t011e-127(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101334112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43000.11e-87NAC domain containing protein 42